Cadillac northstar overheating. Randy Nabors (O-214-613-1416 / Cell 469-446-9712).
Cadillac northstar overheating Northstar overheating. Here are the most common signs of head gasket failure on a Northstar: - Overheating Hi in this video I will show you the real problem for your overheating problem So your Northstar powered car overheated, or it's blowing white smoke. You need to understand the cooling system and how/why it works. Lately, the temperature seems to be climbing a little. . Promar Precision Engines have been pioneers in remanufacturing the 4. I've flushed the radiator several times and refilled the system with the proper amount of DeX cool antifreeze. 6l V8 overheating need advice Interests: Northstar, Cadillac, Computers, Electronics, Tools, Pools, Car Sep 18, 2010 · Here are the most common signs of head gasket failure on a Northstar: - Overheating - High pressure build-up in the coolant surge (fill) tank, that remains when the engine cools off - Heavy white smoke from the tail pipes (condensation & water vapor is completely normal for any car) - Coolant smell from the exhaust I had a Cadillac that that happened too. There are three ways the head gaskets can fail on a Northstar. Apr 20, 2003 · Overheating Northstar. Decision,,Yes I will keep car so have to be repair. Mar 20, 2013 · About 8 months ago she started overheating with the gauge jumping up to the top and the message near the odometer saying that it has shut down the a/c then said to shut the engine off. Lots of cooling system info there. Check your coolant level. Aug 26, 2017 · It had no problems getting home except for losing coolant, she appeared to run fine with no issues although it did have a Cadillac Code for Engine overheating protection. If you do not know the history of this issue, please read cowgirls post about the slushy sound post. The cure, says Cadillac, is to do a ring cleaning procedure (seems those long oil change intervals weren't such a good idea after all). Initial condition: Stabilitrac light on; Loss of engine power; Rough running; Out of State Cadillac dealership attempted ABS repairs / no luck. Study up on the water pump drive assembly belt tensioner pulley. An overheating engine is a definite indication that something is wrong. And when I took the radiator out it weighed close to 40 lbs it seemed like. Aug 25, 2013 · **Want to own the tools I use ?? Click on the amazon link below to get my top 5 Tools I use**Automotive Test Light- https://amzn. Aug 5, 2007 · Check the purge line, belt tensioner & surge tank cap, any of which could cause an overheat situation. I am new to these forums so if this has been discussed already, I apologize in advance. I have had it about 6 months. The thermostat is fairly new, there are no leaks, compression is where it should Jul 23, 2014 · Hi my names justin and im new to these cadillac forums. Thanks to all for you advice and comments. I cant belie Dec 5, 2021 · northstar overheating fix Dec 20, 2022 · Quick question on Northstar "overheating" Jump to Latest 939 views 7 replies 6 participants last post by Submariner409 Dec 22, 2022 Feb 17, 2005 · This resurrected thread has a lot of good Northstar info in it - it's worth a full read. Study the pertinent stickys, marked with a push pin, in this forum and in Engines, Northstar. My 99 Deville was overheating turns out it was Catalytic Converter. Flushed the whole system and later on i blew out the purge line and it fixed my problem and didnt overheat again. Please go to the Engines; Northstar forum and study the several sticky threads concerning cooling systems, fan operation, gauges, and the general thread on the cause(s) of head gasket failures. com - it's the online GM/Cadillac service manuals plus a lot more. Feb 28, 2025 · Correct Northstar oil level is halfway up the dipstick hashmarks. 3 common reasons why Cadillac North Star motors overheat, and blow head gaskets. When driving down the hwy it seems to run fine. 1K views 4 replies 3 participants last post by ConnerJochum Jan 27, 2024 Mar 19, 2014 · Overheating. Pressure tested system & rad cap. the temperature is normal. Aug 19, 2008 · OK - I see that you cleaned the purge line - a common source of Northstar "overheating". Sep 30, 2012 · Overheating Northstar engine 2001 Deville. I will explain the problem as he explained it to me. Water pump and belt. If i accelerate hard or just rev the engine it will usually cool right down. 3 Dec 23, 2022 · Do Google searches for "cadillac forums northstar purge line" and "cadillac forums northstar water pump tensioner pulley". 5. Aug 7, 2019 · Hi All, I haven't been on the forums for a while - life has been busy, and the DTS has been running great (around 105k miles)! Until tonight. Cadillac Rear Main Seal Leak Symptoms. I was specifically looking for a Jul 27, 2019 · My cadillac Deville DHS has the overheat problem, but the place I took it to told me that it would be cheaper to just buy a new car then to fix or replace the Northstar engine! They even commented that Cadillac did that so the car buyer would need to buy a new car after a few 10000's of miles. 6 l v-8 engine Jump to Latest 1. Northstar engines Mar 29, 2024 · Unfortunately, the Cadillac Northstar is prone to overheating, and this overheating process can cause the valve covers to crack and leak oil. Owners/shops were blindly using the crap to excess - with problems like clogged coolant passages, heater cores, purge lines, and excess sludge in the surge tank. alldatadiy. Jul 2, 2005 · General Cadillac Forums ; Northstar overheating. 6L V8 DOHC 32V Already Tried: I've added coolant and tablets purchased at O'Reilly's Auto Parts and I've confirmed that I do have a profuse, visible coolant leak when the engine is not running. But loves to overheat as speeds of 60 mph or higher. Jul 11, 2006 · The Northstar (and most other modern engines) will overheat if the antifreeze content in the coolant is less than 50%, particularly in hot weather and/or at highway speeds. Links Below: Cadillac Northstar engines are known for overheating. If the Cat converter gets plugged up the heat will not get past converter it will back up into engine block causing overheating. I can't believe it. Took it to a repair shop and they took the tanks off and boiled it in a acid bath and cleaned the cores and replaced it with new tanks and my over heating issue was solved. I have an overheating problem. Regular maintenance can help but doesn’t eliminate these common problems. What I did to try to resolve the overheating Cadillac Northstar engine problems. 6 northstar 149,000 miles. and burned oil. Mine only overheated briefly to about 216 and I didn't run it hot. It was designed to offer high performance, reliability, and the latest in engine technology. The dealer told him that because the problem was neither the sensor or How do I prevent my Cadillac from overheating? There are some overheating causes that you can easily prevent yourself: - Always use high-quality coolants: change the coolant every 30,000 miles (50,000 kilometers) or after 2 years. Oil leaks. Sep 1, 2012 · The issue is, many looking to get a used Cadillac with a Northstar can't verify that it has never overheated. It maybe fine with the engine cold but as it heats up, things expand and what didn't leak cold is leaking now. If you see bubbles in the surge tank when you start the engine (cold), no need to go any further. The most common reasons a Cadillac DeVille is overheating are a coolant leak (water pump, radiator, hose etc. as i was driving approx 30 mph the engine started to Jerry Newton ASE Master Technician, L1, Master GM Technician. Clogged CAT is also a possibility. I"m used to working on foreign cars, and my new caddy is confusing me. I have a real problem here. 2005 Cadillac Deville Northstar engine Started overheating while driving about a month ago, 135000 miles on engine. Head Gasket Repairs with 5 year/100,000 mile warranty! For $2500! Nov 17, 2012 · Northstar Overheating Problem- Is it possible to live with or even avoid? 5851 Views 9 Replies 6 Participants Last post by Ranger , Dec 2, 2012 Jump to Latest E Mar 16, 2019 · GM quit using the sealant tabs back in 2006 or so. Jun 2, 2004 · Hi all. Jul 17, 2018 · Overheating on hills is a HG symptom, but the '04 has both upgrades so it is less likely. Only 70,000 on a 97 Northstar. Flushed the whole system out, and I did a block test which came back negative. 3 Jun 1, 2013 · Re: overheating problem with 2000 deville with 4. Stickys are timeless info for every owner of the vehicles/systems in a vehicle thread. 2-coolant gets into the cylinders and you leave a trail of white smoke behind you. May 10, 2008 · Welcome to the 97-99 Northstar Head Gasket Replacement Club!!!!! it could be something other than a head gasket problem, but I strongly believe it is a blown head gasket issue because that is exactly what would happen with my car and I drove it off and on for months like that before succombing to the fact that it was a blown gasket. 6 DOHC 32 Valve Cadillac Northstar Engines. The car has only 74,000 miles. While that may be true most of the time, it pays to do your homework. It has a history of overheating if the outside temperature is 90+ degrees fahrenheit. Aug 4, 2019 · Imagine that, a Cadillac "tech" not knowing to check for a clogged purge line first, when diagnosing an overheat problem on a Northstar. Subscribe the car to www. The Cadillac Northstar LMP program utilized a twin-turbo version of the L47. Overheating issues with northstar motor 9 Answers. However, the complexity of Northstar engines meant they quickly became notorious for head gasket failures. I was stuck in traffic and it overheated on me. For starters, Google "cadillac forums 2000 deville northstar overheating" or something close. Worked great! Tested at highway speeds in 90 degree weather - no overheating. Technician: Todd Hansen. 1993 seville sts, 4. I don't know when(if any) maintance was done on the Aug 14, 2009 · northstar engine overheating thermostat, waterpump,radiator and motor all been replaced - Cadillac 1997 DeVille question Dec 14, 2023 · Buy Cadillac Northstar Complete Head Gasket Repair System - Cooling System Pressure Equalizer & THERMAGASKET Sealer Kit, Quick Install, Eliminate Vaporlock & Overheating, Made in USA: Cooling System - Amazon. Clogs are usually caused by use of various block sealer potions and magic coolant treatments. com FREE DELIVERY possible on eligible purchases Aug 7, 2006 · HI Guys, Just wanted to know if any one out there as any documentation as to when the head gasket issue on the northstar was corrected by Cadillac. Often there is no white smoke from the exhaust, no water in the oil. Jun 4, 2012 · 1998 Cadillac Deville Northstar 4. 1- exhaust gases blow into the cooling system under load, such as when you climb a hill or pass someone. There are NO visible coolant leaks and NO coolant on the floor Jun 18, 2005 · Im havin a problem too, overheating, runs fine, no smoke, fans coming on, just put a thermostat in and flushed the radiatior, still overheating. Jun 28, 2005 · I have a 97 with a northstar 4. The fans work and the radiator is not Jul 7, 2022 · Northstar/cadillac Apr 17, 2020 · For all Northstar owners, but primarily pre-2000 owners, this article from about 2004 was written for CF by a member who was a GM/Cadillac Northstar Powertrain engineer. This is horse shit. Jul 24, 2014 · SOURCE: 1993 Cadillac Eldorado overheating I am assuming you have the Northstar engine. When driven at speeds of 60 miles per hour or less. The purge line has been blown out in the past and the thermostat has been replaced a couple years ago. For more info, Google "cadillac forums northstar engine cooling purge line" or something close. You might also check the engine temp wit an IR thermometer. Sep 10, 2004 · My friend has a 2001 Deville that has an overheating problem. I think its time for a recall. I pulled over to the side Aug 7, 2010 · Hi everyone, I read the forum posts on northstar overheating, but couldn't find a specific answer to my question: I just bought my first northstar, a 1995 seville sts. Spark plugd wires and ignition coils. If you have a misfire the unburnt fuel goes into Mar 29, 2025 · The Northstar V8 engine was once Cadillac's crown jewel, delivering impressive performance and power. Start new topic; Recommended Posts. I have replaced: radiator, water pump, thermostat, water temp sending unit, flushed cooling system & followed manual for refilling cooling system. The Cadillac Northstar rarely exhibits typical blown head gasket symptoms The most common symptoms for a Northstar, are unexplained coolant loss & overheating. See the link below - V V V - Nov 5, 2020 · Hey guys, my deville has 143,000 miles on it and I've been having constant issues with it overheating. Oct 30, 2010 · Old post however the issues with oil loss was covered as internal and external issues BUT the overheating issue was never addressed sufficiently IMO. Jan 9, 2019 · Read the stickies in the Engines; Northstar forums. Gaskets are gone. Customer: I have a 1994 cadillac northstar motor. There is a ton of later info in the sticky threads (marked with a push pin) in the Engines; Northstar forum. Replace the overflow cap. When the engine is running, the leak is a slight infrequent drip. There were 2 fails to properly clamp the heads down and keep the torque even and enough to prevent combustion gasses from entering cooling passages resulting in overheating. ), the radiator fan, or a failed thermostat. Cadillac Northstar owners to those whose vehicle is overheating . Read it all for a better understanding of this remarkable powertrain - the engine was developed from a Lotus design. Anyone trying to get your money should be checked out BEFORE you send anything anywhere. However there is a problem. Have you checked the DTC just in case is has a bad ETC sensor? Not likely, but can't rule it out. The engine is self purging, as long as the purge line is clear. It may be losing coolant and you can't explain where it's going. I think some antifreeze comes out the overflow tube Mar 30, 2019 · With the cooling properties of oil pushed to its limits and the Northstar not actually an air-cooled engine, Cadillac recommends running in limp mode for up to 50 miles although there is some anecdotal evidence on some Cadillac forums of going much further. DO NOT "make it better" with excessive bubble times. I pulled into the driveway after a 25 minute drive home (80°F ambient temperature), windows down (A/C off), I got the message "AC off due to high engine te Jun 21, 2023 · The Northstar V8 came about in 1992 as a replacement for the Cadillac High Technology V8. The car remains cool when it idles. I have a new radiator (since I broke the outflow removing the fans Customer: I have a 2000 Cadillac Deville, 4. Sep 15, 2021 · In 2000 Cadillac redesigned the rear main seal by pressing it into the block which solved the premature wear issues. Now they tell me blown head gasket so I took it to another dealer-he confirmed. No leaks/cap OK. The general L47 produced 320 horsepower and 290 pound-feet 3 days ago · So your Northstar powered car overheated, or it's blowing white smoke. Jul 13, 2016 · Your 2001 Deville Northstar engine has several areas that cause overheating. Downshifting to run the engine (and water pump) faster will cool it down temporarily. I purchased a 96 ETC about a month and a half ago. Jan 13, 2014 · Hello My northstar on seville 2001 start overheating. Randy Nabors (O-214-613-1416 / Cell 469-446-9712). If all that checks out, have a cylinder pressure test done or the coolant tested for exhaust gases. Recommended engine tear-down and partial (or possibly complete) engine I have a 03 deville with an overheating problem a weird heater problem where the driver side gets hot but the passenger side doesn't and I'm clearly not getting cool and all the way through the system because my top hose has very little water in it and stays squishy and never gets hard so the previous odor replaced the water pump I've replaced the thermostat I've checked the top middle line May 11, 2018 · A gasket replacement also cost in the thousands of dollars. When I run the heater around town (in Jul 4, 2013 · Ok so here it is. It has been running great until Sunday. If this is a common Cadillac Northstar problem then my next car is going to be Japanese! Jul 27, 2010 · My cadillac seville sts is overheating, I have reasently changed the alternator, when I did that i removed the radiator hose, and drained the coolant. A cornerstone of older Cadillac models, the Northstar engine was hailed for its cutting-edge technology, becoming synonymous with the Cadillac brand. Valve Cover Oil Leaks. I have had it checked for head gasket problem which there 5 days ago · Cadillac Overheating? YouTube Videos Frequently Asked Questions Making Northstar Engines Stronger Since 2008! Email: info@northstarperformance. My deville ran at between 190 & 201 degrees this morning. Both dealers said this is common on Northstar engines. 6L Northstar engine. I got it for a good price so I couldn't pass it up. At some point the coolant falls dangerously low, the water pump loses pumping action due to cavitation, and the engine overheats. Mar 2, 2016 · You need to go to the forums for Engines; Northstar, Deville, and Seville and look for threads - and stickies - on fans, cooling systems, head gaskets and purge lines. I have a 1999 caddillac seville sls. I purchased and installed STEEL SEAL for NORTHSTAR. Mar 31, 2025 · The proper thermostat for a Northstar V8 is a 195 degree T-stat and the best brand to stick with is AC-Delco when it comes to replacement. Apr 19, 2016 · The new thermostat, with its ring gasket, should settle into the housing and stay there - the coil and wax cartridge goes toward the engine, not toward the radiator. Over the years, the Northstar became synonymous with Cadillac luxury. Mike Cadillac Forums is the perfect place to go to talk about your favorite I have a 2004 cadillac deville, northstar engine with 110,000 miles. This Deville had a slow coolant leak & a history of overheating due to a failed water pump. My advice? First, try to get a 2005-2011 Northstar if you must have one; I admit, they are fantastic engines to drive, sound great, and come with special cars. Here are some things about your Cadillac and what you should do to prevent Overheating and solve diagnose, repair, prevent your 1998 Cadillac Northstar GM en Since the introduction of the Cadillac Northstar engine they have been plagued with cooling system vapor locking problems and head gasket failure! Which comes first. Most of the time when you're on the highway you'll see the engine temperature at 195 degrees F (90 degrees C). I did notice that the hose leading to the thermostat was rock hard, so I replaced the thermostat. 0 engine. but at highway speeds above 70 it will get to the red area if i continue. Cooling System Failures and Overheating. Vehicle details: 2007 Cadillac DTS 4/Automatic transmission/ Cadillac Northstar V8 engine 124,820 miles. 6 Northstar overheating problem in my 06 Lucerne. There is a specific GM/Cadillac/Northstar TSB on coolant tablet use. This problem is worse in town than on the highway. so i filled it up again with water and some coolant, and it starts to overheat, also the fans didnt seem to work so i just connected them to the battery via a switch. I know most of you do not approve of gasket additives, but repair costs exceeded the value of the car. Cadillac recommends using GM cleaning kit (P/N 12378545) and Kent-Moore J-45076 induction/evacuation tool to do the job. The more extreme cases show white smoke – which can still be repaired. Run through a check list of common overheating problems to troubleshoot the source of your engine problem. Jan 14, 2012 · As I have been reading about the Northstar 4. I have a 2001 Cadillac deville northstar engine, which is overheating. I am not loosing water unless it backed out the recovery tank. All attempts to solve the problem has been taken, but no cure. 6 it has a history of overheating while driving down the hwy. What year models have the revised Northstar engine where overheating and blown head gaskets won't be a problem. The car drives great on the highway and most short distances, but there have been 2 times where the engine has overheated (240 degrees or over) once while stuck in traffic after being on the highway, and the other in a drive-through. With the engine idling, that purge line should flow a steady small stream into the surge tank (which floats on the whole coolant system through a T at the bottom), increasing in May 29, 2016 · I can't seem to figure this car out. Been in and out of the shop for ignition problems and a lot of vacuum leaks. I replaced the top on the tank and Jul 24, 2006 · It just took a little. And with the ‘Northstar Condition’ affecting Jul 5, 2010 · Does anyone have the answer to the northstar overheating issue? There has been many post about the issue, but no answer. Perform an engine block exhaust gas test immediately after an overheat event. The car was at the dealer's where they changed the sensor and the thermostat but the problem continues. Northstar overheating can lead to cracked valve covers or bad valve cover gaskets. How to diagnose & repair several Nov 19, 2010 · This is copied from a site on Northstar headgasket diagnostics, it states that your car can pass tests and still have a blown gasket. Jul 12, 2018 · I know, I know the 10 thousandth post on overheating, but please read this very thoroughly and if you have any insight I need help. Check for coolant flow at the Purge line,this is a common problem on the Northstar. Oct 27, 2024 · The Cadillac Northstar engine offers strong performance but is known for issues like head gasket failure, overheating, and oil leaks, often requiring costly repairs. Feb 17, 2016 · A clogged purge line is the most common cause of Northstar overheating. Like all engines, the Northstar requires proper maintenance to stay in good condition. His name is Guss; I cannot spell his last name! The service advisor that was handpicked for me to work with, to be the first to use the SureGrip Head Stud Kit, was Mr. 3 Feb 19, 2018 · Hi I have a 2006 DTS that is almost overheating. Aug 23, 2012 · Remember the Northstar overheating sequence due to failed head gaskets: The intruding exhaust gas overpressurizes the cooling system, which then dutifully vents off gas and coolant through the pressure cap relief. com | We have Jul 4, 2020 · I’ve gotten ahold of a beautiful black 98 DeVille Elegance with only 69,000 miles on it. These cracks are typically no bigger than a hairline, but they can cause the pressure to explode and lead to serious loss of oil which can then bring ruin to the Cadillac Northstar engine system. BEWARE OF SCAMMERS. 6 northstar The cooling system in your car is discussed endlessly in these threads, Cadillac Tech Tips, Northstar Performance sticky posts and main forum as well as up ^^^ in the Cadillac Technical Archive. 6l V8 overheating need advice Northstar 4. With the Climate Control on and in 75-90 degree weather, temperature reaches about 212-222. Sounds like yours had the pre-1999 coolant heated throttlebody - the trick is to bypass that and run the purge line straight from the hollow bolt-nipple to the surge tank nipple. I am having some overheating issues and have cleared all the upper lines, including the removable inlet tube near the thermostat. Years explained are 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2000 – 2005 Northstar L47; 1999 – 2002 Northstar LX5; On the racecourse, the Northstar L47 engine was famous. Top speed was limited to around 65 MPH depending on road conditions and exterior temps. I just disassembled the thermostat housing today, and noticed that someone had hollowed out the thermostat, but left the seal in (INSTANT RED FLAG for me!). Does not seem to get coolant into the engine fast enough. I changed Jul 10, 2024 · The Northstar engine series, introduced in the early 1990s, was General Motors’ answer to the European and Japanese luxury carmakers. Your problem was not the thermostat or water pump. Jul 29, 2005 · Cadillac service bulletin 01-06-01-011 deals with oil burning on 1996-'99 Northstar V8s. Jun 9, 2020 · 2004 Cadillac Deville DHS 238k miles Bought at 100k miles, owned for seven years. My problem is mine overheats while at idle or low rpms. Since Cadillac is a premium brand that has always aimed to compete with the likes of BMW, Mercedes, and Jaguar, the ancient GM pushrod small block wasn’t going to cut it. If this isn't possible, get a Northstar made after 2000. Dont rely on PCM for code. You add/check coolant through the surge tank fill neck, cap off So your Northstar powered car overheated, or it's blowing white smoke. Jul 27, 2013 · Help please! 1998 Deville with 65,000 miles. The L47 Northstar has competed in the 1995 sports car competition with a 650 horsepower variant. who knows, we see customers with vehicles that have less than 50,000 miles that have been babied, then we see vehicles that have 150,000 hard driven city miles that have never had Jun 7, 2014 · I just bought this gorgeous White one owner 70,000 mile 1999 Cadillac Deville. to/3z1PdxaFlexible Backprobe Jan 26, 2024 · northstar 4. (Northstar engine) The car is pretty much flawless. I changed the radiator,thermostat, waterpump. On the highway, it cools to a low of 196. I have so far replaced the waterpump and thermostat, found a couple lines that were leaking and replaced them. Jul 28, 2017 · Northstar 4. I bought it with overheating problems i changed the thermostat. See the sticky TSB (GM/Cadillac Technical Service Bulletin) in Engines; Northstar on piston ring cleaning and oil level. I am 3rd owner of this car. Part of the problem is that many people (as well as "techs") automatically assume that an overheating Northstar has bad HG's. Feb 25, 2014 · spiked the temp - resulting a false "overheating" warning - by shutting the engine off - the air pocket got "burped" - so coolant flow was restored around the temp sensor - and quickly displayed the correct coolant temp - and a compression test is next to useless in diagnosing a failed head gasket in a Northstar motor - May 27, 2004 · Northstar Engines and System Technical Discussion. By rvaddict July 2, 2005 in General Cadillac Forums. I order head bolts repair kit and head gasket full set from CCC(thank you CCC) Cadillac Northstar Engine Head Gasket Repair. This article also has necessary info, primarily for the pre-2000 Northstar owner. Cadillac Forums is the perfect place to go to talk about your favorite Caddys including the ATS, CTS, SRX, Escalade Aug 24, 2013 · I have a Cadillac DTS 2008 and it is overheating, I can drive for about 40 minutes then when I stop at a red light the temperature gauge goes up, if I remain idle in traffic for a long period of time, the car will overheat and show a display of A/C overheating engine shutting off it does not say anything about coolant, the thermostat was changed Nov 17, 2010 · Crest Cadillac has one of the best Northstar engine men in the country. Sep 30, 2007 · Northstar Engines and System Technical Discussion overheating there N* motors. 3 days ago · So your Northstar powered car overheated, or it's blowing white smoke. No visible leaks. Dec 2, 2007 · Re: 1998 Cadillac Deville overheating Have the mechanic check the purge line and cap, but if he wants to start replacing high dollar items, make sure he tests the coolant for exhaust gases before doing so. We were one of the first Mar 16, 2009 · Re: 1999 Cadillac Seville OVERHEATING If it is the hg, would it overheat all the time? I tried to get it to overheat last night by driving around for about an hour (fast, stop and go, everything) and I only got the temp to raise about and 1/8 inch and then it went back down after about a minute but the gurgling water sound seems to be getting louder/worse. Low engine oil; Oil dripping from back of the block; 3. I have only put about 5k miles on it. After a few minutes of driving it will hit the red and the shut off ac light will come on. In Economy mode, it can climb as high as 233-238. Can`t stop overheating. Tags 1953 Cadillac Eldorado Convertible 1954 Cadillac Coupe de Ville 1993 Cadillac Fleetwood Brougham (Sold) 1996 Cadillac Fleetwood Brougham Apr 20, 2020 · Hello everyone, I’m back again with another 4. ykftxscgblafhboqvmrqcelkgkpleqckhwvyqgsafdtpicoprczmvgtnftomdalwqbpu